PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F00378.1.p
Common NameEUGRSUZ_F00378
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 293aa    MW: 32764.6 Da    PI: 6.5192
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F00378.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.7e-1873126356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+++++++q+++Le+ Fe ++++  e++++LA++l+L+ rqV +WFqNrRa++k
  Eucgr.F00378.1.p  73 KKRRLSANQVKALEKNFEIENKLEPERKARLAEELSLQPRQVAIWFQNRRARWK 126
                       56689************************************************9 PP

2HD-ZIP_I/II126.89.4e-4172164193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrls++qvk+LE++Fe e+kLeperK++la+eL lqprqva+WFqnrRAR+ktkqlE+d+ +Lk++yd+lk + ++Le+e+e+L++el+e
  Eucgr.F00378.1.p  72 EKKRRLSANQVKALEKNFEIENKLEPERKARLAEELSLQPRQVAIWFQNRRARWKTKQLERDFGHLKASYDSLKLDFDSLEQEKESLAAELTE 164
                       69**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.33E-1867130IPR009057Homeodomain-like
PROSITE profilePS5007117.03868128IPR001356Homeobox domain
SMARTSM003892.6E-1671132IPR001356Homeobox domain
CDDcd000861.91E-1573129No hitNo description
PfamPF000461.5E-1573126IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.6E-1975133IPR009057Homeodomain-like
PROSITE patternPS000270103126IPR017970Homeobox, conserved site
PfamPF021838.4E-17128169IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MKRLSSSDSS DVWISMCSGK EGNKRLARHF LVATAEEKVL KKSQGYSIEF QAMLDSLDQE  60
DHSGEEAGLI TEKKRRLSAN QVKALEKNFE IENKLEPERK ARLAEELSLQ PRQVAIWFQN  120
RRARWKTKQL ERDFGHLKAS YDSLKLDFDS LEQEKESLAA ELTELKVKLR RETSESSNHC  180
AVKHESPLSE SSEDGKPGSC SGSVKEDPNP TPELPPSSAA PPLPLRYGSC STSPPPPPPP  240
PPPPSSSRGT TAGRGYYHQV RMEENHPSGF ISEESCNFFS VDQPPTLHWY FP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197103ERKARLA
2120128RRARWKTKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F00378.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010060054.11e-178PREDICTED: homeobox-leucine zipper protein ATHB-6-like
TrEMBLA0A059BKM80.0A0A059BKM8_EUCGR; Uncharacterized protein
STRINGVIT_18s0001g06430.t014e-78(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.11e-53homeobox protein 16